PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_5F686B67C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 287aa    MW: 30294.7 Da    PI: 6.2647
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_5F686B67C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.99.8e-0860106245
                            SSS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwq 45 
                            g WT e  + + +a ++   g     W++Ia  +g g+t++++k ++ 
  Traes_2DL_5F686B67C.1  60 GGWTWEQNKAFENALALVDLGegeaVWNKIADAVG-GKTAEEIKRHYE 106
                            56*************99888888************.**********95 PP

2Myb_DNA-binding38.92e-12171214447
                            S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Traes_2DL_5F686B67C.1 171 WTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 214
                            *****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.64557113IPR017884SANT domain
SMARTSM007170.006958111IPR001005SANT/Myb domain
PfamPF002491.6E-560106IPR001005SANT/Myb domain
SuperFamilySSF466896.89E-961116IPR009057Homeodomain-like
CDDcd001671.35E-562109No hitNo description
PROSITE profilePS5129415.914163219IPR017930Myb domain
SuperFamilySSF466893.01E-16166220IPR009057Homeodomain-like
SMARTSM007173.0E-10167217IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-17167217IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-10170213IPR009057Homeodomain-like
CDDcd001671.15E-9171215No hitNo description
PfamPF002496.5E-11171214IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSAMVTEEGS RFGSGGWMWE QDMVFESTPA LVDLEKGEAV WNNMAGVVEV KGSGSGSGPG  60
GWTWEQNKAF ENALALVDLG EGEAVWNKIA DAVGGKTAEE IKRHYELLVA DVDAIEAGRV  120
PLPVYTDGGS PEEGGSGGKK GGGRVGGGRG GHGPKGSSKS VEQEGRKGIL WTEDEHRLFL  180
LGLEKYGKGD WRSISRNFVI SRTPTQVASH AQKYFIRLNS MNRERRRSSI HDITSVNGEA  240
SAAQGPITGT NGQAAVPGKS PKQSPHQPGN LPPGVDAFGT TIGQPVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1552130279RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139148KGGGRVGGGR
2141147GGRVGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3669321e-167AK366932.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2048J09.
GenBankAK3726191e-167AK372619.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3007D08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-103hypothetical protein SORBIDRAFT_06g032880
SwissprotQ8S9H73e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLW5BV080.0W5BV08_WHEAT; Uncharacterized protein
STRINGMLOC_72275.21e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-70MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]